PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g14500.1.p
Common NameBRADI_3g14500, LOC100838099
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 832aa    MW: 88550.1 Da    PI: 6.3709
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g14500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.65.9e-20144199156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL++ l+L+  qVk+WFqN+R++ k
  Bradi3g14500.1.p 144 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRMLNLEPLQVKFWFQNKRTQIK 199
                       688999**********************************************9987 PP

2START162.92.4e-513235631206
                       HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS..............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-T CS
             START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.............dsgealrasgvvdmvlallveellddkeqWde 74 
                       ela +a++el+++a ++ep+Wv ss      e + ++e+ + f+ +++              ++ea+r++gvv+m++a+lv++l+d+  qW+ 
  Bradi3g14500.1.p 323 ELAVAAMEELIRMARLGEPLWVPSSslsvggETLVEEEYSRLFPGKHSssssspapaenhpPRSEASRETGVVIMDQATLVSILMDVH-QWSS 414
                       57899******************99889988778888888888666669999******9999**************************.**** PP

                       T-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEE.EEEEEEEE......TTS-EEEEEEEEE-TTS--.-TTSEE-EESSE CS
             START  75 tla....kaetlevissg......galqlmvaelqalsplvp.Rdf.vfvRyirq.....lgagdwvivdvSvdseqkppesssvvRaellpS 150
                        +     +a+tlev+s+g      galqlm+aelq++splvp R+  +f+Ry++       gag+w++vdvS+d+   +++    +R  ++ S
  Bradi3g14500.1.p 415 VFSsivsRAATLEVLSTGvagnldGALQLMSAELQVPSPLVPtRELpLFLRYCKHhphgaGGAGTWAVVDVSLDNSGRNSN----IR--RRAS 501
                       *********************************************879*******99998899**************9997....77..8*** PP

                       EEEEEEECTCEEEEEEEE-EE-......-SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 151 giliepksnghskvtwvehvdl......kgrlphwllrslvksglaegaktwvatlqrqcek 206
                       g++i++++ng+skvtw+eh++l       ++++h+l+++lv sg+a+ga++wv+tl+rqce+
  Bradi3g14500.1.p 502 GCVIQEMPNGYSKVTWIEHTELpaaasaADSMVHELYKPLVASGTAFGARRWVSTLKRQCER 563
                       *********************944444346789***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-22123199IPR009057Homeodomain-like
SuperFamilySSF466892.72E-19136201IPR009057Homeodomain-like
PROSITE profilePS5007117.054141201IPR001356Homeobox domain
SMARTSM003898.5E-19142205IPR001356Homeobox domain
PfamPF000461.6E-17144199IPR001356Homeobox domain
CDDcd000864.04E-19144202No hitNo description
PROSITE patternPS000270176199IPR017970Homeobox, conserved site
PROSITE profilePS5084836.095314566IPR002913START domain
SuperFamilySSF559614.26E-26316565No hitNo description
CDDcd088752.73E-99318562No hitNo description
SMARTSM002342.9E-38323563IPR002913START domain
PfamPF018529.5E-42324563IPR002913START domain
SuperFamilySSF559619.16E-22584819No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 832 aa     Download sequence    Send to blast
MPGGMMVPGG GGRNMIGGGG GRSSNGVGGG YGSSSSSALS LGQNMMDGGM LHQQHHQLPA  60
ILQHHLVDHH GHLLPQHQHQ QAATSESDAR GPHGIGGRNS NNDELEMSKS GGSNNLDGGG  120
GEEEDQQEEE DEEPAADGKR PRKKKRYHRH TQHQIQELEA FFKECPHPDD KQRKELSRML  180
NLEPLQVKFW FQNKRTQIKT QHERQENTAL RTENEKLRAE NMRYKEALAN ASCPSCGGPA  240
AIGEMSFDEH HLRLENARLR DEIDRISAIA AKYVGGAGAS AIKPSSLPPA AYPPPVESSH  300
LTGSMIFSGG GHGGELDKPM VIELAVAAME ELIRMARLGE PLWVPSSSLS VGGETLVEEE  360
YSRLFPGKHS SSSSSPAPAE NHPPRSEASR ETGVVIMDQA TLVSILMDVH QWSSVFSSIV  420
SRAATLEVLS TGVAGNLDGA LQLMSAELQV PSPLVPTREL PLFLRYCKHH PHGAGGAGTW  480
AVVDVSLDNS GRNSNIRRRA SGCVIQEMPN GYSKVTWIEH TELPAAASAA DSMVHELYKP  540
LVASGTAFGA RRWVSTLKRQ CERLASAAMS VHPSSADSVV TSAEGRRSML RLAERMTASF  600
CGGVAASATH QWTTLSGSGE ADVRVMTRKS VDDPGRPPGI ILNAATSFWL PVSPAEVFAF  660
LRDDSTRSEW DILSNGGVVH EMAHIANGQN HGNAVSLLRV NNANANQSNM LILQESSTDE  720
EGGWSYVVYA PVDVVAMNVV LNGGDPDYVA LLPSGFAILP DGTPPDSGGN GGCVGGGGGS  780
LLTVAFQILV DSVPTAKLSL GSVATVNSLI ACTVDRIKNA VVVSASDHHH R*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11018GGRNMIGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757114.10.0PREDICTED: homeobox-leucine zipper protein ROC7-like
RefseqXP_014757113.10.0PREDICTED: homeobox-leucine zipper protein ROC7-like
RefseqXP_014757112.10.0PREDICTED: homeobox-leucine zipper protein ROC7-like
RefseqXP_010234287.20.0PREDICTED: homeobox-leucine zipper protein ROC7-like
SwissprotA3BPF20.0ROC7_ORYSJ; Homeobox-leucine zipper protein ROC7
TrEMBLA0A0Q3HNM90.0A0A0Q3HNM9_BRADI; Uncharacterized protein
STRINGBRADI3G14500.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2